PDB entry 1jku

View 1jku on RCSB PDB site
Description: Crystal Structure of Manganese Catalase from Lactobacillus plantarum
Deposited on 2001-07-13, released 2002-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2002-07-13, with a file datestamp of 2002-07-13.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.147
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1jkua_
  • Chain 'B':
    Domains in SCOP 1.69: d1jkub_
  • Chain 'C':
    Domains in SCOP 1.69: d1jkuc_
  • Chain 'D':
    Domains in SCOP 1.69: d1jkud_
  • Chain 'E':
    Domains in SCOP 1.69: d1jkue_
  • Chain 'F':
    Domains in SCOP 1.69: d1jkuf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkuA (A:)
    mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
    dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
    pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
    hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
    yqenpeamggiphikpgdprlhnhqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkuB (B:)
    mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
    dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
    pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
    hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
    yqenpeamggiphikpgdprlhnhqg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkuC (C:)
    mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
    dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
    pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
    hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
    yqenpeamggiphikpgdprlhnhqg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkuD (D:)
    mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
    dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
    pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
    hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
    yqenpeamggiphikpgdprlhnhqg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkuE (E:)
    mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
    dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
    pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
    hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
    yqenpeamggiphikpgdprlhnhqg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkuF (F:)
    mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
    dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
    pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
    hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
    yqenpeamggiphikpgdprlhnhqg