PDB entry 1jkq

View 1jkq on RCSB PDB site
Description: Testing the Water-Mediated HIN Recombinase DNA Recognition by Systematic Mutations
Class: DNA binding protein/DNA
Keywords: water-mediated recognition, protein-DNA complex, hin recombinase, g9t mutant, DNA binding protein/DNA complex
Deposited on 2001-07-13, released 2002-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.256
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*tp*gp*tp*tp*tp*tp*tp*tp*ap*tp*ap*ap*gp*a)-3'
  • Chain 'B':
    Compound: 5'-d(*ap*tp*cp*tp*tp*ap*tp*ap*ap*ap*ap*ap*ap*c)-3'
  • Chain 'C':
    Compound: DNA-invertase hin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jkqc_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jkqC (C:)
    grprainkheqeqisrllekghprqqlaiifgigvstlyryfpassikkrmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jkqC (C:)
    rprainkheqeqisrllekghprqqlaiifgigvstlyryfpassi