PDB entry 1jko

View 1jko on RCSB PDB site
Description: Testing the Water-Mediated HIN Recombinase DNA Recognition by Systematic Mutations
Deposited on 2001-07-12, released 2002-02-22
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-22, with a file datestamp of 2002-02-22.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.244
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.59: d1jkoc_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkoC (C:)
    grprainkheqeqisrllekghprqqlaiifgigvstlyryfpass