PDB entry 1jko

View 1jko on RCSB PDB site
Description: Testing the Water-Mediated HIN Recombinase DNA Recognition by Systematic Mutations
Class: DNA binding protein/DNA
Keywords: water-mediated recognition, protein-DNA complex, hin recombinase, a10g mutant, DNA binding protein/DNA complex
Deposited on 2001-07-12, released 2002-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.244
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*tp*gp*tp*tp*tp*tp*tp*gp*gp*tp*ap*ap*gp*a)-3'
  • Chain 'B':
    Compound: 5'-d(*ap*tp*cp*tp*tp*ap*cp*cp*ap*ap*ap*ap*ap*c)-3'
  • Chain 'C':
    Compound: DNA-invertase hin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jkoc_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jkoC (C:)
    grprainkheqeqisrllekghprqqlaiifgigvstlyryfpassikkrmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jkoC (C:)
    grprainkheqeqisrllekghprqqlaiifgigvstlyryfpass