PDB entry 1jkn

View 1jkn on RCSB PDB site
Description: Solution Structure of the Nudix Enzyme Diadenosine Tetraphosphate Hydrolase from Lupinus angustifolius Complexed with ATP
Class: hydrolase
Keywords: alpha-beta-alpha sandwich, enzyme-substrate complex, HYDROLASE
Deposited on 2001-07-12, released 2002-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diadenosine 5',5'''-p1,p4-tetraphosphate hydrolase
    Species: Lupinus angustifolius [TaxId:3871]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04841 (5-164)
      • cloning artifact (0-4)
    Domains in SCOPe 2.06: d1jkna1, d1jkna2
  • Heterogens: ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jknA (A:)
    gplgsmdsppegyrrnvgiclmnndkkifaasrldipdawqmpqggidegedprnaaire
    lreetgvtsaeviaevpywltydfppkvreklniqwgsdwkgqaqkwflfkftgqdqein
    llgdgsekpefgewswvtpeqlidltvefkkpvykevlsvfaphl