PDB entry 1jkn

View 1jkn on RCSB PDB site
Description: Solution Structure of the Nudix Enzyme Diadenosine Tetraphosphate Hydrolase from Lupinus angustifolius Complexed with ATP
Class: hydrolase
Keywords: alpha-beta-alpha sandwich, enzyme-substrate complex
Deposited on 2001-07-12, released 2002-02-27
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: diadenosine 5',5'''-p1,p4-tetraphosphate hydrolase
  Species: Lupinus angustifolius
  Database cross-references and differences (RAF-indexed):
  • Uniprot O04841 (5-164)
    • cloning artifact (0-4)
  Domains in SCOP 1.73: d1jkna_
• Heterogens: ATP

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jknA (A:)
  gplgsmdsppegyrrnvgiclmnndkkifaasrldipdawqmpqggidegedprnaaire
  lreetgvtsaeviaevpywltydfppkvreklniqwgsdwkgqaqkwflfkftgqdqein
  llgdgsekpefgewswvtpeqlidltvefkkpvykevlsvfaphl