PDB entry 1jkj

View 1jkj on RCSB PDB site
Description: E. coli SCS
Class: ligase
Keywords: CITRIC ACID CYCLE, HETEROTETRAMER, LIGASE, ATP-grasp fold, Rossmann Fold
Deposited on 2001-07-12, released 2002-01-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.192
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinyl-CoA synthetase alpha subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jkja1, d1jkja2
  • Chain 'B':
    Compound: succinyl-CoA synthetase beta subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jkjb1, d1jkjb2
  • Chain 'D':
    Compound: succinyl-CoA synthetase alpha subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jkjd1, d1jkjd2
  • Chain 'E':
    Compound: succinyl-CoA synthetase beta subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jkje1, d1jkje2
  • Heterogens: PO4, SO4, COA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jkjA (A:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jkjA (A:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkjB (B:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaavegk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jkjD (D:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jkjD (D:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jkjE (E:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaavegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jkjE (E:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaav