PDB entry 1jkg

View 1jkg on RCSB PDB site
Description: Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA nuclear export factor
Class: transport protein
Keywords: NTF2-like domain, TRANSPORT PROTEIN
Deposited on 2001-07-12, released 2001-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p15
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jkga_
  • Chain 'B':
    Compound: tap
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBU9 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1jkgb1, d1jkgb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jkgA (A:)
    masvdfktyvdqacraaeefvnvyyttmdkrrrllsrlymgtatlvwngnavsgqeslse
    ffemlpssefqisvvdcqpvhdeatpsqttvlvvicgsvkfegnkqrdfnqnfiltaqas
    psntvwkiasdcfrfqdwas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jkgA (A:)
    asvdfktyvdqacraaeefvnvyyttmdkrrrllsrlymgtatlvwngnavsgqeslsef
    femlpssefqisvvdcqpvhdeatpsqttvlvvicgsvkfegnkqrdfnqnfiltaqasp
    sntvwkiasdcfrfqdwas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jkgB (B:)
    appckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfipqnpar
    sslaeyfkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtst
    llcfsvngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafa
    mpaptpssspvptlspeqqemlqafstqsgmnlewsqkclqdnnwdytrsaqafthlkak
    geipevafmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jkgB (B:)
    appckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfisslaey
    fkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtstllcfsv
    ngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafampaptp