PDB entry 1jkb

View 1jkb on RCSB PDB site
Description: human lysozyme mutant with glu 35 replaced by ala
Class: lysozyme
Keywords: lysozyme, muramidase, hydrolase (o-glycosyl) hydrolase, muramidase, hydrolase (o-glycosyl), glycosidase
Deposited on 1996-11-13, released 1997-05-15
The last revision prior to the SCOP 1.75 freeze date was dated 1997-05-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.178
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Gene: A SYNTHETIC GENE OF HUMAN LYSO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (34)
    Domains in SCOP 1.75: d1jkba_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkbA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwasgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv