PDB entry 1jka

View 1jka on RCSB PDB site
Description: human lysozyme mutant with glu 35 replaced by asp
Class: hydrolase
Keywords: hydrolase, muramidase, hydrolase (o-glycosyl), glycosidase
Deposited on 1996-11-13, released 1997-05-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.178
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Gene: A SYNTHETIC GENE OF HUMAN LYSO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (34)
    Domains in SCOPe 2.03: d1jkaa_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jkaA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwdsgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv