PDB entry 1jk1

View 1jk1 on RCSB PDB site
Description: Zif268 D20A Mutant Bound to WT DNA Site
Class: transcription/DNA
Keywords: Zinc Finger, Double-Stranded DNA, protein-DNA complex, TRANSCRIPTION/DNA COMPLEX
Deposited on 2001-07-11, released 2001-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zif268
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08046
      • engineered (19)
    Domains in SCOPe 2.08: d1jk1a1, d1jk1a2, d1jk1a3
  • Chain 'B':
    Compound: 5'-d(*ap*gp*cp*gp*tp*gp*gp*gp*cp*gp*g)-3'
  • Chain 'C':
    Compound: 5'-d(*tp*cp*cp*gp*cp*cp*cp*ap*cp*gp*c)-3'
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1jk1A (A:)
merpyacpvescdrrfsrsaeltrhirihtgqkpfqcricmrnfsrsdhltthirthtge
kpfacdicgrkfarsderkrhtkihlrqkd

    Sequence, based on observed residues (ATOM records): (download) 
    >1jk1A (A:)
rpyacpvescdrrfsrsaeltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
facdicgrkfarsderkrhtkihlr

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.