PDB entry 1jjw

View 1jjw on RCSB PDB site
Description: Structure of Haemophilus influenzae HslV Protein at 1.9 A Resolution
Class: hydrolase
Keywords: K anomalous scattering, quasi-equivalent packing, HYDROLASE
Deposited on 2001-07-09, released 2001-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HslV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jjwa_
  • Chain 'B':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HslV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jjwb_
  • Chain 'C':
    Compound: ATP-dependent protease hslv
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HslV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jjwc_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jjwA (A:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjwA (A:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jjwB (B:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjwB (B:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jjwC (C:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjwC (C:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp