PDB entry 1jjs

View 1jjs on RCSB PDB site
Description: nmr structure of ibid, a domain of cbp/p300
Deposited on 2001-07-09, released 2001-10-03
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-03, with a file datestamp of 2001-10-03.
Experiment type: NMR12
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jjsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jjsA (A:)
    alqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjsA (A:)
    alqdllrtlkspsspqvlnilksnpqlmaafikqrtakyvan