PDB entry 1jjs

View 1jjs on RCSB PDB site
Description: NMR Structure of IBiD, A Domain of CBP/p300
Class: transcription
Keywords: Transcription regulation, Coactivator
Deposited on 2001-07-09, released 2001-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jjsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jjsA (A:)
    gahmalqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjsA (A:)
    alqdllrtlkspsspqvlnilksnpqlmaafikqrtakyvan