PDB entry 1jjr

View 1jjr on RCSB PDB site
Description: the three-dimensional structure of the c-terminal dna binding domain of human ku70
Deposited on 2001-07-09, released 2001-10-03
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-24, with a file datestamp of 2001-10-24.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jjra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jjrA (A:)
    kveyseeelkthiskgtlgkftvpmlkeacrayglksglkkqellealtkhfqd