PDB entry 1jjr

View 1jjr on RCSB PDB site
Description: The Three-Dimensional Structure of the C-terminal DNA Binding Domain of Human Ku70
Class: DNA binding protein
Keywords: DNA repair protein, Protein-DNA interaction, Ku70, solution structure, DNA BINDING PROTEIN
Deposited on 2001-07-09, released 2001-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thyroid autoantigen
    Species: Homo sapiens [TaxId:9606]
    Gene: Ku70
    Database cross-references and differences (RAF-indexed):
    • GB AAA61177 (97-150)
    Domains in SCOPe 2.08: d1jjra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jjrA (A:)
    mgsshhhhhhssglvprgshmaspegkvtkrkhdnegsgskrpkveyseeelkthiskgt
    lgkftvpmlkeacrayglksglkkqellealtkhfqdkveyseeelkthiskgtlgkftv
    pmlkeacrayglksglkkqellealtkhfqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjrA (A:)
    kveyseeelkthiskgtlgkftvpmlkeacrayglksglkkqellealtkhfqd