PDB entry 1jjo

View 1jjo on RCSB PDB site
Description: Crystal Structure of Mouse Neuroserpin (Cleaved form)
Class: signaling protein
Keywords: Serpin, Serine protease inhibitor, Neuronal serpin, SIGNALING PROTEIN
Deposited on 2001-07-09, released 2002-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.06 Å
R-factor: 0.232
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroserpin
    Species: Mus musculus [TaxId:10090]
    Gene: SERPINI1 or PI12 or SPI17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jjo.1
  • Chain 'B':
    Compound: neuroserpin
    Species: Mus musculus [TaxId:10090]
    Gene: SERPINI1 or PI12 or SPI17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jjo.2
  • Chain 'C':
    Compound: neuroserpin
    Species: Mus musculus [TaxId:10090]
    Gene: SERPINI1 or PI12 or SPI17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jjo.1
  • Chain 'D':
    Compound: neuroserpin
    Species: Mus musculus [TaxId:10090]
    Gene: SERPINI1 or PI12 or SPI17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jjo.2
  • Chain 'E':
    Compound: neuroserpin
    Species: Mus musculus [TaxId:10090]
    Gene: SERPINI1 or PI12 or SPI17
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35684 (0-30)
      • see remark 999 (31-32)
    Domains in SCOPe 2.07: d1jjo.1
  • Chain 'F':
    Compound: neuroserpin
    Species: Mus musculus [TaxId:10090]
    Gene: SERPINI1 or PI12 or SPI17
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35684 (0-30)
      • see remark 999 (31-32)
    Domains in SCOPe 2.07: d1jjo.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jjoA (A:)
    titewsvnmynhlrgtgedenilfsplsialamgmmelga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jjoB (B:)
    titewsvnmynhlrgtgedenilfsplsialamgmmelga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jjoC (C:)
    enqyvmklanslfvqngfhvneeflqmlkmyfnaevnhvdfsqnvavansinkwvenytn
    sllkdlvspedfdgvtnlalinavyfkgnwksqfrpentrtfsftkddesevqipmmyqq
    gefyygefsdgsneaggiyqvleipyegdeismmlalsrqevplatlepllkaqlieewa
    nsvkkqkvevylprftveqeidlkdilkalgvteifikdanltamsdkkelflskavhks
    cievneegseaaaasgmiais
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjoC (C:)
    enqyvmklanslfvqngfhvneeflqmlkmyfnaevnhvdfsqnvavansinkwvenytn
    sllkdlvspedfdgvtnlalinavyfkgnwksqfrpentrtfsftkddesevqipmmyqq
    gefyygefsdgsneaggiyqvleipyegdeismmlalsrqevplatlepllkaqlieewa
    nsvkkqkvevylprftveqeidlkdilkalgvteflskavhkscievneegseaaaasgm
    iais
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jjoD (D:)
    enqyvmklanslfvqngfhvneeflqmlkmyfnaevnhvdfsqnvavansinkwvenytn
    sllkdlvspedfdgvtnlalinavyfkgnwksqfrpentrtfsftkddesevqipmmyqq
    gefyygefsdgsneaggiyqvleipyegdeismmlalsrqevplatlepllkaqlieewa
    nsvkkqkvevylprftveqeidlkdilkalgvteifikdanltamsdkkelflskavhks
    cievneegseaaaasgmiais
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjoD (D:)
    enqyvmklanslfvqngfhvneeflqmlkmyfnaevnhvdfsqnvavansinkwvenytn
    sllkdlvspedfdgvtnlalinavyfkgnwksqfrpentrtfsftkddesevqipmmyqq
    gefyygefsdgsneaggiyqvleipyegdeismmlalsrqevplatlepllkaqlieewa
    nsvkkqkvevylprftveqeidlkdilkalgvteflskavhkscievneegseaaaasgm
    iais
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jjoE (E:)
    ypqvivdhpflylirnrksgiilfmgrvmnphh
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jjoF (F:)
    ypqvivdhpflylirnrksgiilfmgrvmnphh