PDB entry 1jjk

View 1jjk on RCSB PDB site
Description: Selenomethionine Substitution of Orotidine-5'-monophosphate Decarboxylase from E. coli Causes a Change in Crystal Contacts and Space Group
Class: lyase
Keywords: alpha-beta-barrel, protein-inhibitor complex, homodimer, LYASE
Deposited on 2001-07-06, released 2001-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjka_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjkb_
  • Chain 'C':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjkc_
  • Chain 'D':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjkd_
  • Chain 'E':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjke_
  • Chain 'F':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjkf_
  • Chain 'G':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjkg_
  • Chain 'H':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjkh_
  • Chain 'I':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjki_
  • Chain 'J':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjkj_
  • Chain 'K':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjkk_
  • Chain 'L':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjkl_
  • Chain 'M':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjkm_
  • Chain 'N':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjkn_
  • Chain 'O':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjko_
  • Chain 'P':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08244
      • modified residue (48)
      • modified residue (94)
      • modified residue (105-106)
      • modified residue (132)
      • modified residue (142)
      • modified residue (204)
      • modified residue (217)
    Domains in SCOPe 2.07: d1jjkp_
  • Heterogens: BMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jjkA (A:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkA (A:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jjkB (B:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkB (B:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jjkC (C:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkC (C:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jjkD (D:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkD (D:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jjkE (E:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkE (E:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1jjkF (F:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkF (F:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1jjkG (G:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkG (G:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jjkH (H:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkH (H:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1jjkI (I:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkI (I:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1jjkJ (J:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkJ (J:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1jjkK (K:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkK (K:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1jjkL (L:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkL (L:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1jjkM (M:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkM (M:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1jjkN (N:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkN (N:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1jjkO (O:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkO (O:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1jjkP (P:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjkP (P:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq