PDB entry 1jjh

View 1jjh on RCSB PDB site
Description: E2 DNA-binding Domain from Bovine Papillomavirus Type 1
Class: DNA binding protein
Keywords: BPV-1, E2, DNA-binding domain, DNA BINDING PROTEIN
Deposited on 2001-07-05, released 2001-07-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein E2
    Species: Bovine papillomavirus type 1 [TaxId:10559]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03122 (1-85)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1jjha1, d1jjha2
  • Chain 'B':
    Compound: Regulatory protein E2
    Species: Bovine papillomavirus type 1 [TaxId:10559]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03122 (1-85)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1jjhb1, d1jjhb2
  • Chain 'C':
    Compound: Regulatory protein E2
    Species: Bovine papillomavirus type 1 [TaxId:10559]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jjhc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jjhA (A:)
    ascfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaerqgqaqilitfgsps
    qrqdflkhvplppgmnisgftasldf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjhA (A:)
    ascfalisgtanqvkcyrfrvkknhrhryenctttwftvqaqilitfgspsqrqdflkhv
    plppgmnisgftasldf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jjhB (B:)
    ascfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaerqgqaqilitfgsps
    qrqdflkhvplppgmnisgftasldf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjhB (B:)
    ascfalisgtanqvkcyrfrvkknhrhryenctttwftvaqaqilitfgspsqrqdflkh
    vplppgmnisgftasldf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jjhC (C:)
    ascfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaerqgqaqilitfgsps
    qrqdflkhvplppgmnisgftasldf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjhC (C:)
    scfalisgtanqvkcyrfrvkknhrhryenctttwfaqilitfgspsqrqdflkhvplpp
    gmnisgftasldf