PDB entry 1jje

View 1jje on RCSB PDB site
Description: imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a biaryl succinic acid inhibitor (11)
Class: hydrolase
Keywords: metallo-beta-lactamase inhibitor, succinic acid inhibitor, imp-1 metallo-beta-lactamase, hydrolase
Deposited on 2001-07-04, released 2001-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: imp-1 metallo beta-lactamase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jjea_
  • Chain 'B':
    Compound: imp-1 metallo beta-lactamase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jjeb_
  • Heterogens: ZN, ACT, BYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jjeA (A:)
    aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
    twfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
    vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
    kllkskygkaklvvpshsevgdasllkltleqavkglneskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjeA (A:)
    slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
    fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
    ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
    lkskygkaklvvpshsevgdasllkltleqavkglneskk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jjeB (B:)
    aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
    twfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
    vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
    kllkskygkaklvvpshsevgdasllkltleqavkglneskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jjeB (B:)
    aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
    twfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
    vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
    kllkskygkaklvvpshsevgdasllkltleqavkglnesk