PDB entry 1jj4

View 1jj4 on RCSB PDB site
Description: Human papillomavirus type 18 E2 DNA-binding domain bound to its DNA target
Class: transcription/DNA
Keywords: HPV-18, E2, DNA-binding domain, E2-DNA complex, TRANSCRIPTION/DNA COMPLEX
Deposited on 2001-07-03, released 2001-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06790 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.06: d1jj4a1, d1jj4a2
  • Chain 'B':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06790 (4-End)
      • cloning artifact (2-3)
    Domains in SCOPe 2.06: d1jj4b1, d1jj4b2
  • Chain 'C':
    Compound: E2 binding site DNA
  • Chain 'D':
    Compound: E2 binding site DNA
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jj4A (A:)
    gshmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetq
    rtkflntvaipdsvqilvgymtm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jj4A (A:)
    mtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtktgiltvtyhsetqrtkflntv
    aipdsvqilvgymt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jj4B (B:)
    gshmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetq
    rtkflntvaipdsvqilvgymtm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jj4B (B:)
    hmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtektgiltvtyhsetqrtkfln
    tvaipdsvqilvgymt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.