PDB entry 1jj2

View 1jj2 on RCSB PDB site
Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution
Deposited on 2001-07-03, released 2001-08-01
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-01, with a file datestamp of 2001-08-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.57: d1jj21_
  • Chain '2':
    Domains in SCOP 1.57: d1jj22_
  • Chain 'A':
    Domains in SCOP 1.57: d1jj2a1, d1jj2a2
  • Chain 'B':
    Domains in SCOP 1.57: d1jj2b_
  • Chain 'C':
    Domains in SCOP 1.57: d1jj2c_
  • Chain 'D':
    Domains in SCOP 1.57: d1jj2d_
  • Chain 'E':
    Domains in SCOP 1.57: d1jj2e1, d1jj2e2
  • Chain 'F':
    Domains in SCOP 1.57: d1jj2f_
  • Chain 'G':
    Domains in SCOP 1.57: d1jj2g_
  • Chain 'H':
    Domains in SCOP 1.57: d1jj2h_
  • Chain 'I':
    Domains in SCOP 1.57: d1jj2i_
  • Chain 'J':
    Domains in SCOP 1.57: d1jj2j_
  • Chain 'K':
    Domains in SCOP 1.57: d1jj2k_
  • Chain 'L':
    Domains in SCOP 1.57: d1jj2l_
  • Chain 'M':
    Domains in SCOP 1.57: d1jj2m_
  • Chain 'N':
    Domains in SCOP 1.57: d1jj2n_
  • Chain 'O':
    Domains in SCOP 1.57: d1jj2o_
  • Chain 'P':
    Domains in SCOP 1.57: d1jj2p_
  • Chain 'Q':
    Domains in SCOP 1.57: d1jj2q_
  • Chain 'R':
    Domains in SCOP 1.57: d1jj2r_
  • Chain 'S':
    Domains in SCOP 1.57: d1jj2s_
  • Chain 'T':
    Domains in SCOP 1.57: d1jj2t_
  • Chain 'U':
    Domains in SCOP 1.57: d1jj2u_
  • Chain 'V':
    Domains in SCOP 1.57: d1jj2v_
  • Chain 'W':
    Domains in SCOP 1.57: d1jj2w_
  • Chain 'X':
    Domains in SCOP 1.57: d1jj2x_
  • Chain 'Y':
    Domains in SCOP 1.57: d1jj2y_
  • Chain 'Z':
    Domains in SCOP 1.57: d1jj2z_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1jj21 (1:)
    gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jj21 (1:)
    gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj22 (2:)
    mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
    ptkktdlkyrcgecgkahlregwragrlefqe
    

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2A (A:)
    grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
    edgdrrlilapegvgvgdelqvgvdaeiapgntlplaeipegvpvcnvesspgdggkfar
    asgvnaqllthdrnvavvklpsgemkrldpqcratigvvggggrtdkpfvkagnkhhkmk
    argtkwpnvrgvamnavdhpfggggrqhpgkpksisrnappgrkvgdiaskrtgrgg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2B (B:)
    pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
    pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
    pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
    ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
    pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
    vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2C (C:)
    mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
    fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
    adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
    argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
    aevaer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jj2D (D:)
    fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
    gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
    vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jj2D (D:)
    fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
    lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
    hrlnpadavafiestydvev
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2E (E:)
    prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
    tigtfqshienmfhgvtegweygmevfyshfpmqvnvegdevvienflgekaprrttihg
    dtdveidgeeltvsgpdieavgqtaadieqltrindkdvrvfqdgvyitrkp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2F (F:)
    pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
    mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jj2H (H:)
    kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
    leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
    taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jj2H (H:)
    kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
    leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
    fiawvnpdpnveeawrrakmkvtptinidsspagna
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2I (I:)
    aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
    gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
    lsnikfvtlgeisetlganktw
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2J (J:)
    mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
    tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
    fgsvasaatmiv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1jj2K (K:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
    iaddfsegarekvegaggsveltdlgeerq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jj2K (K:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
    segarekvegaggsveltdlgeerq
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2L (L:)
    arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
    ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
    gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
    ekvrpslrvngaka
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2M (M:)
    atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
    ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
    gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
    dgdiel
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2N (N:)
    sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
    pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2O (O:)
    tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
    rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
    dlydkagggefdsvadleryida
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2P (P:)
    pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
    gtvegkqgdaykvdivdggkektiivtaahlrrqe
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2Q (Q:)
    gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
    qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
    eqqgrkpramgrasawnspqvdvelileep
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2R (R:)
    swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
    ekkavvrlsedddaqevasri
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2S (S:)
    skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
    evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2T (T:)
    recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2U (U:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegd
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2V (V:)
    mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
    tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
    prgghdgvkhpvkeggqlgkhdtegiddlleamr
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2W (W:)
    ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
    pskirvraarfeeegeaiveae
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2X (X:)
    telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
    rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
    erieeeaedagirvlnptyvev
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2Y (Y:)
    rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
    qpetvagkavmka
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj2Z (Z:)
    tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage