PDB entry 1jiw

View 1jiw on RCSB PDB site
Description: Crystal structure of the APR-APRin complex
Deposited on 2001-07-03, released 2001-08-15
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-15, with a file datestamp of 2001-08-15.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.184
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jiwI (I:)
    sslillsasdlagqwtlqqdeapaichlelrdsevaeasgydlggdtacltrwlpsepra
    wrptpagiallerggltlmllgrqgegdyrvqkgdggqlvlrrat
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jiwP (P:)
    grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys
    fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg
    dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh
    tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia
    aiqklyganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqn
    qkinlnekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilyg
    glgadqlwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyv
    dafagkagqailsydaaskagslaidfsgdahadfainligqatqadivv