PDB entry 1jiu

View 1jiu on RCSB PDB site
Description: T4 Phage BGT in Complex with Mg2+ : Form I
Class: transferase
Keywords: Glycosyltransferase
Deposited on 2001-07-03, released 2001-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA beta-glucosyltransferase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jiua_
  • Heterogens: MG, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jiuA (A:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
    yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
    tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
    nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
    nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl