PDB entry 1jir

View 1jir on RCSB PDB site
Description: crystal structure of trypsin complex with amylamine in cyclohexane
Deposited on 2001-07-02, released 2001-07-18
The last revision prior to the SCOP 1.71 freeze date was dated 2001-07-18, with a file datestamp of 2001-07-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1jira_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jirA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn