PDB entry 1jio

View 1jio on RCSB PDB site
Description: P450eryF/6DEB
Class: hydrolase
Keywords: Cytochrome P450, P450, 6-deoxyerythronolide B, 6-DEB, HYDROLASE
Deposited on 2001-07-02, released 2001-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 107a1
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jioa_
  • Heterogens: HEM, DEB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jioA (A:)
    ttvpdlesdsfhvdwyrtyaelretapvtpvrflgqdawlvtgydeakaalsdlrlssdp
    kkkypgvevefpaylgfpedvrnyfatnmgtsdppthtrlrklvsqeftvrrveamrprv
    eqitaelldevgdsgvvdivdrfahplpikvicellgvdekyrgefgrwsseilvmdper
    aeqrgqaarevvnfildlverrrtepgddllsalirvqddddgrlsadeltsialvllla
    gfeasvsligigtylllthpdqlalvrrdpsalpnaveeilryiappetttrfaaeevei
    ggvaipqystvlvangaanrdpkqfpdphrfdvtrdtrghlsfgqgihfcmgrplakleg
    evalralfgrfpalslgidaddvvwrrslllrgidhlpvrldg