PDB entry 1jij

View 1jij on RCSB PDB site
Description: Crystal structure of S. aureus TyrRS in complex with SB-239629
Class: ligase
Keywords: tyrosyl-trna synthetase, staphylococcus aureus, truncation, structure based inhibitor design, LIGASE
Deposited on 2001-07-02, released 2001-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.257
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • GB BAB42818
    Domains in SCOPe 2.06: d1jija_
  • Heterogens: 629

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jijA (A:)
    mtnvliedlkwrgliyqqtdeqgiedllnkeqvtlycgadptadslhighllpfltlrrf
    qehghrpivligggtgmigdpsgkseervlqteeqvdkniegiskqmhnifefgtdhgav
    lvnnrdwlgqislisflrdygkhvgvnymlgkdsiqsrlehgisyteftytilqaidfgh
    lnrelnckiqvggsdqwgnitsgielmrrmygqtdaygltiplvtksdgkkfgksesgav
    wldaektspyefyqfwinqsdedvikflkyftflgkeeidrleqskneaphlreaqktla
    eevtkfihgedalndairisqalfsgdlkslsakelkdgfkdvpqvtlsndttnivevli
    etgispskrqaredvnngaiyingerqqdvnyalapedkidgeftiirrgkkkyfmvnyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jijA (A:)
    tnvliedlkwrgliyqqtdeqgiedllnkeqvtlycgadptadslhighllpfltlrrfq
    ehghrpivligggtgmigdpsgkseervlqteeqvdkniegiskqmhnifefgtdhgavl
    vnnrdwlgqislisflrdygkhvgvnymlgkdsiqsrlehgisyteftytilqaidfghl
    nrelnckiqvggsdqwgnitsgielmrrmygqtdaygltiplvtksdgkkfgksesgavw
    ldaektspyefyqfwinqsdedvikflkyftflgkeeidrleqskneaphlreaqktlae
    evtkfihgedalndairis