PDB entry 1jig

View 1jig on RCSB PDB site
Description: Dlp-2 from Bacillus anthracis
Class: metal transport
Keywords: dodecamer, four-helix bundle, metal transport
Deposited on 2001-07-02, released 2002-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.186
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dlp-2
    Species: Bacillus anthracis [TaxId:1392]
    Gene: dlp-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jiga_
  • Chain 'B':
    Compound: Dlp-2
    Species: Bacillus anthracis [TaxId:1392]
    Gene: dlp-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jigb_
  • Chain 'C':
    Compound: Dlp-2
    Species: Bacillus anthracis [TaxId:1392]
    Gene: dlp-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jigc_
  • Chain 'D':
    Compound: Dlp-2
    Species: Bacillus anthracis [TaxId:1392]
    Gene: dlp-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jigd_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jigA (A:)
    stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
    ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
    atsadmllaihttleqhvwmlsaflk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jigB (B:)
    stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
    ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
    atsadmllaihttleqhvwmlsaflk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jigC (C:)
    stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
    ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
    atsadmllaihttleqhvwmlsaflk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jigD (D:)
    stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
    ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
    atsadmllaihttleqhvwmlsaflk