PDB entry 1jig

View 1jig on RCSB PDB site
Description: Dlp-2 from Bacillus anthracis
Deposited on 2001-07-02, released 2002-06-19
The last revision prior to the SCOP 1.69 freeze date was dated 2002-06-19, with a file datestamp of 2002-06-19.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.186
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1jiga_
  • Chain 'B':
    Domains in SCOP 1.69: d1jigb_
  • Chain 'C':
    Domains in SCOP 1.69: d1jigc_
  • Chain 'D':
    Domains in SCOP 1.69: d1jigd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jigA (A:)
    stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
    ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
    atsadmllaihttleqhvwmlsaflk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jigB (B:)
    stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
    ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
    atsadmllaihttleqhvwmlsaflk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jigC (C:)
    stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
    ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
    atsadmllaihttleqhvwmlsaflk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jigD (D:)
    stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
    ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
    atsadmllaihttleqhvwmlsaflk