PDB entry 1jid

View 1jid on RCSB PDB site
Description: Human SRP19 in complex with helix 6 of Human SRP RNA
Class: signaling protein/RNA
Keywords: signal recognition particle (srp), protein-RNA complex, ggag tetraloop, signaling protein/RNA complex
Deposited on 2001-07-02, released 2001-10-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle 19 kda protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1jida_
  • Chain 'B':
    Compound: helix 6 of human srp RNA
    Species: synthetic, synthetic
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1jidA (A:)
macaaarspadqdrficiypaylnnkktiaegrripiskavenptateiqdvcsavglnv
fleknkmysrewnrdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktrtq
lehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1jidA (A:)
aarspadqdrficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvflek
nkmysrewnrdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktr

  • Chain 'B':
    No sequence available.