PDB entry 1jid

View 1jid on RCSB PDB site
Description: Human SRP19 in complex with helix 6 of Human SRP RNA
Class: signaling protein/RNA
Keywords: signal recognition particle (srp), protein-RNA complex, ggag tetraloop
Deposited on 2001-07-02, released 2001-10-19
The last revision prior to the SCOP 1.75 freeze date was dated 2001-10-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle 19 kda protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jida_
  • Chain 'B':
    Compound: helix 6 of human srp RNA
    Species: synthetic, synthetic
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jidA (A:)
    macaaarspadqdrficiypaylnnkktiaegrripiskavenptateiqdvcsavglnv
    fleknkmysrewnrdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktrtq
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jidA (A:)
    aarspadqdrficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvflek
    nkmysrewnrdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktr
    

  • Chain 'B':
    No sequence available.