PDB entry 1jid

View 1jid on RCSB PDB site
Description: human srp19 in complex with helix 6 of human srp rna
Deposited on 2001-07-02, released 2001-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2001-10-19, with a file datestamp of 2001-10-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1jida_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jidA (A:)
    macaaarspadqdrficiypaylnnkktiaegrripiskavenptateiqdvcsavglnv
    fleknkmysrewnrdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktrtq
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jidA (A:)
    aarspadqdrficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvflek
    nkmysrewnrdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktr