PDB entry 1jic

View 1jic on RCSB PDB site
Description: solution nmr structure of recombinant sso7d with rnase activity, minimized average structure
Deposited on 1998-07-20, released 1998-10-14
The last revision prior to the SCOP 1.57 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1jic__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jic_ (-)
    atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
    qk