PDB entry 1jic

View 1jic on RCSB PDB site
Description: solution nmr structure of recombinant sso7d with RNAse activity, minimized average structure
Class: DNA binding protein
Keywords: thermostable ribonuclease, DNA-binding, sulfolobus solfataricus, RNAse and DNA-binding protein, DNA-binding protein, DNA binding protein
Deposited on 1998-07-20, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sso7d
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jica_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jicA (A:)
    atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
    qk