PDB entry 1jia

View 1jia on RCSB PDB site
Description: structure of a basic phospholipase a2 from agkistrodon halys pallas at 2.13a resolution
Class: phospholipase
Keywords: phospholipase a2, agkistrodon halys pallas crystal structure
Deposited on 1997-06-09, released 1998-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.152
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42187 (0-121)
      • conflict (18)
      • conflict (57)
      • conflict (71)
      • conflict (84)
      • conflict (89)
    Domains in SCOPe 2.06: d1jiaa_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42187 (0-121)
      • conflict (18)
      • conflict (57)
      • conflict (71)
      • conflict (84)
      • conflict (89)
    Domains in SCOPe 2.06: d1jiab_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jiaA (A:)
    hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
    wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
    kc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jiaB (B:)
    hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
    wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
    kc