PDB entry 1ji7

View 1ji7 on RCSB PDB site
Description: Crystal Structure of TEL SAM Polymer
Class: transcription
Keywords: Helical polymer, TRANSCRIPTION
Deposited on 2001-06-29, released 2002-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.184
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ets-related protein tel1
    Species: Homo sapiens [TaxId:9606]
    Gene: TEL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41212 (0-76)
      • modified residue (42)
      • conflict (65)
    Domains in SCOPe 2.07: d1ji7a_
  • Chain 'B':
    Compound: ets-related protein tel1
    Species: Homo sapiens [TaxId:9606]
    Gene: TEL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41212 (0-76)
      • modified residue (42)
      • conflict (65)
    Domains in SCOPe 2.07: d1ji7b_
  • Chain 'C':
    Compound: ets-related protein tel1
    Species: Homo sapiens [TaxId:9606]
    Gene: TEL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41212 (0-76)
      • modified residue (42)
      • conflict (65)
      • his-tag (77-84)
    Domains in SCOPe 2.07: d1ji7c1, d1ji7c2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ji7A (A:)
    sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
    phsgdelyellqhilkqrdhhhhhhhrhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ji7A (A:)
    sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
    phsgdelyellqhilkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ji7B (B:)
    sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
    phsgdelyellqhilkqrdhhhhhhhrhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ji7B (B:)
    sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
    phsgdelyellqhilkq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ji7C (C:)
    sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
    phsgdelyellqhilkqrdhhhhhhhrhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ji7C (C:)
    sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
    phsgdelyellqhilkqrdhhhhhh