PDB entry 1ji5

View 1ji5 on RCSB PDB site
Description: Dlp-1 from bacillus anthracis
Deposited on 2001-06-29, released 2002-06-19
The last revision prior to the SCOP 1.69 freeze date was dated 2002-06-19, with a file datestamp of 2002-06-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ji5a_
  • Chain 'B':
    Domains in SCOP 1.69: d1ji5b_
  • Chain 'C':
    Domains in SCOP 1.69: d1ji5c_
  • Chain 'D':
    Domains in SCOP 1.69: d1ji5d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji5A (A:)
    qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
    ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
    dlllgiytelekhawmlrafln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji5B (B:)
    qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
    ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
    dlllgiytelekhawmlrafln
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji5C (C:)
    qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
    ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
    dlllgiytelekhawmlrafln
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji5D (D:)
    qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
    ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
    dlllgiytelekhawmlrafln