PDB entry 1ji2

View 1ji2 on RCSB PDB site
Description: Improved X-ray Structure of Thermoactinomyces vulgaris R-47 alpha-Amylase 2
Class: hydrolase
Keywords: beta/alpha barrel, hydrolase
Deposited on 2001-06-28, released 2002-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase II
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji2a1, d1ji2a2, d1ji2a3
  • Chain 'B':
    Compound: alpha-amylase II
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji2b1, d1ji2b2, d1ji2b3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji2A (A:)
    mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
    gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
    vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
    yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
    vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
    pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas
    gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
    dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
    rglfefykelirlrhrlasltrgnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqt
    vllqvpesggktwldcltgeevhgkqgqlkltlrpyqgmilwngr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji2B (B:)
    mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
    gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
    vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
    yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
    vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
    pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas
    gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
    dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
    rglfefykelirlrhrlasltrgnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqt
    vllqvpesggktwldcltgeevhgkqgqlkltlrpyqgmilwngr