PDB entry 1ji0

View 1ji0 on RCSB PDB site
Description: Crystal Structure Analysis of the ABC transporter from Thermotoga maritima
Class: transport protein
Keywords: ATP binding protein, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSPORT PROTEIN
Deposited on 2001-06-28, released 2002-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0M3 (0-239)
      • insertion (1)
      • modified residue (80)
      • modified residue (102-103)
      • modified residue (146)
      • modified residue (154)
      • modified residue (161-162)
      • modified residue (230)
    Domains in SCOPe 2.08: d1ji0a_
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji0A (A:)
    mvsdivlevqslhvyygaihaikgidlkvprgqivtligangagktttlsaiaglvraqk
    gkiifngqditnkpahvinrmgialvpegrrifpeltvyenlmmgaynrkdkegikrdle
    wifslfprlkerlkqlggtlsggeqqmlaigralmsrpkllmmdepslglapilvsevfe
    viqkinqegttillveqnalgalkvahygyvletgqivlegkaselldnemvrkaylgva