PDB entry 1jhw

View 1jhw on RCSB PDB site
Description: Ca2+-binding Mimicry in the Crystal Structure of the Eu3+-Bound Mutant Human Macrophage Capping Protein Cap G
Class: structural protein
Keywords: actin, human, capping, cap g, macrophage, gcap39, mbhl, gelsolin, structural protein
Deposited on 2001-06-28, released 2002-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.248
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage capping protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40121
      • see remark 999 (82-89)
      • see remark 999 (123-136)
    Domains in SCOPe 2.08: d1jhwa1, d1jhwa2, d1jhwa3
  • Heterogens: EU3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jhwA (A:)
    mytaipqsgspfpgsvqdpglhvwrveklkpvpvaqenqgvffsgdsylvlhngpeevsh
    lhlwigqqssrdeqgacavlavqlddylggrpvqhrevqgnesdlfmsyfprglkyqegg
    vesgfkhvvpnevvvqrlyqvkgaknirateralnwdsfntgdcfildlgqnifawcggk
    snilernkardlalairdserqgkaqveivtdgeepaemiqvlgpkpalkegnpeedlta
    dkanaqaaalykvsdatgqmnltkvadsspfalellisddcfvldnglcgkiyiwkgrka
    nekerqaalqvaegfisrmqyapntqveilpqgrespifkqffkdwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jhwA (A:)
    pfpgsvqdpglhvwrveklkpvpvaqenqgvffsgdsylvlhngpeevshlhlwigqqss
    rdeqgacavlavqlddylggrpvqhrevqgnesdlfmsyfprglkyqeggvesgfkhvvp
    nevvvqrlyqvkgaknirateralnwdsfntgdcfildlgqnifawcggksnilernkar
    dlalairdserqgkaqveivtdgeepaemiqvlgpkpalkegnpaqaaalykvsdatgqm
    nltkvadsspfalellisddcfvldnglcgkiyiwkgrkanekerqaalqvaegfisrmq
    yapntqveilpqgrespifkqffkdw