PDB entry 1jhb

View 1jhb on RCSB PDB site
Description: human glutaredoxin in fully reduced form, nmr, 20 structures
Class: electron transport
Keywords: glutaredoxin, oxidoreductase, nmr, electron transport
Deposited on 1998-02-17, released 1998-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jhba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jhbA (A:)
    maqefvnckiqpgkvvvfikptcpycrraqeilsqlpikqgllefvditatnhtneiqdy
    lqqltgartvprvfigkdciggcsdlvslqqsgelltrlkqigalq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jhbA (A:)
    aqefvnckiqpgkvvvfikptcpycrraqeilsqlpikqgllefvditatnhtneiqdyl
    qqltgartvprvfigkdciggcsdlvslqqsgelltrlkqigalq