PDB entry 1jh7

View 1jh7 on RCSB PDB site
Description: Semi-reduced Inhibitor-bound Cyclic Nucleotide Phosphodiesterase from Arabidopsis thaliana
Class: hydrolase
Keywords: ADP-ribose 1'',2''-cyclic phosphate, RNA processing, 2',3'-cyclic nucleotide phosphodiesterase, 2',3'-cyclic uridine vanadate, HYDROLASE
Deposited on 2001-06-27, released 2002-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.214
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclic phosphodiesterase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04147 (0-180)
      • expression tag (181-184)
    Domains in SCOPe 2.07: d1jh7a1, d1jh7a2
  • Heterogens: SO4, UVC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jh7A (A:)
    meevkkdvysvwalpdeeseprfkklmealrseftgprfvphvtvavsayltadeakkmf
    esacdglkaytatvdrvstgtfffqcvflllqttpevmeagehcknhfncstttpymphl
    sllyaelteeekknaqekaytldssldglsfrlnrlalcktdtedktletwetvavcnln
    pgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jh7A (A:)
    meevkkdvysvwalpdeeseprfkklmealrseftgprfvphvtvavsayltadeakkmf
    esacdglkaytatvdrvstgtfffqcvflllqttpevmeagehcknhfncstttpymphl
    sllyaelteeekknaqekaytldssldglsfrlnrlalcktdtedktletwetvavcnln
    pgshh