PDB entry 1jh2

View 1jh2 on RCSB PDB site
Description: Crystal structure of tetradecameric Mycobacterium tuberculosis chaperonin 10 at 2.8A resolution.
Class: chaperone
Keywords: beta-barrels, acidic cluster
Deposited on 2001-06-27, released 2001-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-07-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jh2a_
  • Chain 'B':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jh2b_
  • Chain 'C':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jh2c_
  • Chain 'D':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jh2d_
  • Chain 'E':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jh2e_
  • Chain 'F':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jh2g_
  • Chain 'H':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jh2h_
  • Chain 'I':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jh2i_
  • Chain 'J':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jh2l_
  • Chain 'M':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jh2m_
  • Chain 'N':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis
    Gene: Heat shock protein chaperonin 10, groES
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jh2n_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jh2A (A:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jh2B (B:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jh2B (B:)
    kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
    vaegdtviyskyggteikyngeeylilsardvlavvsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jh2C (C:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jh2C (C:)
    kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
    vaegdtviyskyggteikyngeeylilsardvlavvsk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jh2D (D:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jh2D (D:)
    kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
    vaegdtviyskyggteikyngeeylilsardvlavvsk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jh2E (E:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1jh2G (G:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jh2G (G:)
    kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
    vaegdtviyskyggteikyngeeylilsardvlavvsk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jh2H (H:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jh2H (H:)
    kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
    vaegdtviyskyggteikyngeeylilsardvlavvsk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1jh2I (I:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jh2I (I:)
    kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
    vaegdtviyskyggteikyngeeylilsardvlavvsk
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1jh2L (L:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jh2L (L:)
    kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
    vaegdtviyskyggteikyngeeylilsardvlavvsk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1jh2M (M:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jh2M (M:)
    kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
    vaegdtviyskyggteikyngeeylilsardvlavvsk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1jh2N (N:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jh2N (N:)
    kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
    vaegdtviyskyggteikyngeeylilsardvlavvsk