PDB entry 1jh1

View 1jh1 on RCSB PDB site
Description: Crystal Structure of MMP-8 complexed with a 6H-1,3,4-thiadiazine derived inhibitor
Deposited on 2001-06-27, released 2001-12-27
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-27, with a file datestamp of 2001-12-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jh1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jh1A (A:)
    npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
    rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
    lahssdpgalmypnyafretsnyslpqddidgiqaiyg