PDB entry 1jgv

View 1jgv on RCSB PDB site
Description:
Deposited on 2001-06-26, released 2001-12-05
The last revision prior to the SCOP 1.65 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.206
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1jgvh1, d1jgvh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1jgvl1, d1jgvl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jgvH (H:)
    evklvesrgglvkpggslqlscaasgftfsgyamswfrltpekrlewvasiyngfrihyl
    dsvkgrftissdyarnilylqmstlrsedtamyycsrgdaysryfdvwgagttvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jgvL (L:)
    evvmtqsplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec