PDB entry 1jgt

View 1jgt on RCSB PDB site
Description: crystal structure of beta-lactam synthetase
Deposited on 2001-06-26, released 2001-12-28
The last revision prior to the SCOP 1.67 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jgtA (A:)
    mgapvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdr
    avarsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngr
    fatvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvag
    ltgvyqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtp
    gdtplvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreiti
    pttellaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhre
    drlpaldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhg
    rdkwvlraamadalpaetvnrpklgvhegsgttssfsrllldhgvaedrvheakrqvvre
    lfdltvgggrhpsevdtddvvrsvadrtargaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jgtA (A:)
    pvlpaafgflasartgggpvfatrgshtdidtpqgerslaatlvhapsvapdravarslt
    gapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfatvvrt
    gdrvllatdhagsvplytcvapgevrasteakalaahpkgfpladarrvagltgvyqvpa
    gavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtpgdtplvvls
    ggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreitipttellaql
    pyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhredrlpaldtv
    lahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhgrdkwvlraa
    madalpaetvnrpklssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtd
    dvvrsvadrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jgtB (B:)
    mgapvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdr
    avarsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngr
    fatvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvag
    ltgvyqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtp
    gdtplvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreiti
    pttellaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhre
    drlpaldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhg
    rdkwvlraamadalpaetvnrpklgvhegsgttssfsrllldhgvaedrvheakrqvvre
    lfdltvgggrhpsevdtddvvrsvadrtargaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jgtB (B:)
    gapvlpaafgflasartgggpgpvfatrgshtdidtpqgerslaatlvhapsvapdrava
    rsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfat
    vvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvagltg
    vyqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtpgdt
    plvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreitiptt
    ellaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhredrl
    paldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhgrdk
    wvlraamadalpaetvnrpklsgttssfsrllldhgvaedrvheakrqvvrelfdltvgg
    grhpsevdtddvvrsvadrt