PDB entry 1jgl

View 1jgl on RCSB PDB site
Description: Crystal structure of immunoglobulin Fab fragment complexed with 17-beta-estradiol
Class: immune system
Keywords: antibody, four-center hydrogen bond, steroid
Deposited on 2001-06-26, released 2001-10-10
The last revision prior to the SCOP 1.73 freeze date was dated 2002-12-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.199
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Ig gamma-1-chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAB53773 (0-End)
    Domains in SCOP 1.73: d1jglh1, d1jglh2
  • Chain 'L':
    Compound: Ig kappa-chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q920E6 (0-End)
      • see remark 999 (117)
    Domains in SCOP 1.73: d1jgll1, d1jgll2
  • Heterogens: EST, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jglH (H:)
    qiqlvqsgpelkkpgetvrisckasdysfmtsgmqwvqqmpgkglkwigwlntqsgvpey
    aedfkgrfafsletsattaylqinnlknedtatyfcatwggnsaywgqgttltvssaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jglH (H:)
    qiqlvqsgpelkkpgetvrisckasdymtsgmqwvqqmpgkglkwigwlntqsgvpeyae
    dfkgrfafslettaylqinnlknedtatyfcatwggnsaywgqgttltvssakttppsvy
    plapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpsst
    wpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1jglL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyychhfwstpwtfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jglL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyychhfwstpwtfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne