PDB entry 1jgf

View 1jgf on RCSB PDB site
Description: crystal structure of plasmepsin IV from p. falciparum in complex with pepstatin a
Class: hydrolase
Keywords: eukaryotic aspartic proteinase
Deposited on 2001-06-25, released 2002-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2002-06-12, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.18
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmepsin IV
    Species: Plasmodium falciparum
    Domains in SCOPe 2.07: d1jgfa_
  • Chain 'B':
    Compound: plasmepsin IV
    Species: Plasmodium falciparum
    Domains in SCOPe 2.07: d1jgfb_
  • Heterogens: IHN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jgfA (A:)
    sendsielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlyda
    sasksyekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsef
    dgilglgwkdlsigsidpvvvelkkqnkidnalftfylpvhdkhvgyltiggiesdfyeg
    pltyeklnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvp
    flplyvttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfi
    lgdpfmrkyftvfdyekesvgfavaknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jgfB (B:)
    sendsielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlyda
    sasksyekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsef
    dgilglgwkdlsigsidpvvvelkkqnkidnalftfylpvhdkhvgyltiggiesdfyeg
    pltyeklnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvp
    flplyvttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfi
    lgdpfmrkyftvfdyekesvgfavaknl