PDB entry 1jg8

View 1jg8 on RCSB PDB site
Description: Crystal Structure of Threonine Aldolase (Low-specificity)
Class: lyase
Keywords: glycine biosynthesis, threonine aldolase, pyridoxal-5'-phosphate, calcium binding site, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, LYASE
Deposited on 2001-06-23, released 2001-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1744
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X266 (4-346)
      • modified residue (202)
    Domains in SCOPe 2.06: d1jg8a_
  • Chain 'B':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1744
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X266 (4-346)
      • modified residue (202)
    Domains in SCOPe 2.06: d1jg8b_
  • Chain 'C':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1744
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X266 (4-346)
      • modified residue (202)
    Domains in SCOPe 2.06: d1jg8c_
  • Chain 'D':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1744
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X266 (4-346)
      • cloning artifact (3)
      • modified residue (202)
    Domains in SCOPe 2.06: d1jg8d1, d1jg8d2
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jg8A (A:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jg8A (A:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jg8B (B:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jg8B (B:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jg8C (C:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jg8C (C:)
    midlrsdtvtkpteemrkamevgddvygedptinelerlaaetfgkeaalfvpsgtmgnq
    vsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkairprn
    ihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasgvpv
    keyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaagiia
    ltkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfiealrns
    gvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jg8D (D:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jg8D (D:)
    mmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgt
    mgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkai
    rprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasias
    gvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaa
    giialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfiea
    lrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs