PDB entry 1jg7

View 1jg7 on RCSB PDB site
Description: T4 phage BGT in complex with UDP and Mn2+
Class: transferase
Keywords: Glycosyltransferase
Deposited on 2001-06-23, released 2001-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.209
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA beta-glucosyltransferase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jg7a_
  • Heterogens: MN, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jg7A (A:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
    yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
    tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
    nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
    nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl